PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012567279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 331aa    MW: 37472.5 Da    PI: 9.7106
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012567279.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.27.7e-28130183155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+ Wt eLH++Fv+av+qL G +kA Pk+i+++m+v+gLt++h++SHLQk+Rl
  XP_012567279.1 130 KARVAWTVELHQQFVRAVKQL-GVDKAGPKRIMKIMNVNGLTRAHIASHLQKFRL 183
                     68*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.92E-51461IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.0E-71469No hitNo description
PROSITE profilePS5129413.081127186IPR017930Myb domain
SuperFamilySSF466894.12E-19128187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-29128187IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-22130183IPR006447Myb domain, plants
PfamPF002495.0E-8132181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MPLLSCSNLL SLSVMSSDGT TSSVMRAIEN GACDYWIKPL HEKQIKNMWI HAARKLMNEN  60
KKQEINRKNL EFEGKKIKGE KDDLILGLID ATSEGVKIDP KEGCSKVIVE KSDYVIEKDN  120
LNENEPSTKK ARVAWTVELH QQFVRAVKQL GVDKAGPKRI MKIMNVNGLT RAHIASHLQK  180
FRLYLKREET HKHLQQKKQQ QQNGTVKAID SNNSNGSEGF DNHALALTNH VLNPLIEVPK  240
HDHHQNQNSS NAQLKTSTMW PNFKHESYGC NSSNQHVSSN TLLQHEYAPS SSSYGKWVPT  300
ESSNHLVDPA NIRNLILMKN VTNTKPMQQE T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16127187262ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012567279.10.0PREDICTED: two-component response regulator ARR14-like isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01760.11e-35response regulator 14